Loading...
Statistics
Advertisement

Revscale Media, LLC
www.revscale.com/

Revscale.com

Advertisement
Conversion Technology Metas Server
Revscale.com is hosted in United States . Revscale.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Font Awesome, Google Font API, Number of used javascripts: 1. First javascripts: Lander.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: cloudflare-nginx.

Technologies in use by Revscale.com

Technology

Number of occurences: 6
  • CSS
  • Font Awesome
  • Google Font API
  • Html
  • Html5
  • Javascript

Advertisement

Javascripts

Number of occurences: 1
  • lander.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • cloudflare-nginx

CDN

Number of occurences: 3
  • BootstrapCDN
  • CloudFlare
  • Maxcdn

Social

Number of occurences: 1
  • Facebook Box

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Revscale.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Multi-Domain/CN=sni307352.cloudflaressl.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Multi-Domain
      • CN: sni307352.cloudflaressl.com
    • hash: ebdf1eab
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO ECC Domain Validation Secure Server CA 2
    • version: 2
    • serialNumber: 15868892084892950879453311672989536843
    • validFrom: 160707000000Z
    • validTo: 170108235959Z
    • validFrom_time_t: 1467849600
    • validTo_time_t: 1483919999
    • extensions:
      • authorityKeyIdentifier: keyid:40:09:61:67:F0:BC:83:71:4F:DE:12:08:2C:6F:D4:D4:2B:76:3D:96
      • subjectKeyIdentifier: A6:D4:84:25:FA:A1:9E:DF:5D:67:21:5B:89:12:72:D5:0A:1E:71:1C
      • keyUsage: Digital Signature
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crt OCSP - URI:http://ocsp.comodoca4.com
      • subjectAltName: DNS:sni307352.cloudflaressl.com, DNS:*.childcustody-attorney.xyz, DNS:*.defense-lawyer.xyz, DNS:*.edcsniper.com, DNS:*.employment-lawyer.xyz, DNS:*.findmedicalmalpracticelawyers.xyz, DNS:*.goatdm.com, DNS:*.gunnage.com, DNS:*.lumpiafest.com, DNS:*.make-diabetes-work.com, DNS:*.necklacerow.com, DNS:*.octoberpair.net, DNS:*.revscale.com, DNS:*.shanemdonovan.com, DNS:*.sisters-movie.link, DNS:*.starta5k.com, DNS:*.tmnv.com, DNS:*.traffic-lawyers.xyz, DNS:*.twistyband.com, DNS:*.wantalicious.com, DNS:childcustody-attorney.xyz, DNS:defense-lawyer.xyz, DNS:edcsniper.com, DNS:employment-lawyer.xyz, DNS:findmedicalmalpracticelawyers.xyz, DNS:goatdm.com, DNS:gunnage.com, DNS:lumpiafest.com, DNS:make-diabetes-work.com, DNS:necklacerow.com, DNS:octoberpair.net, DNS:revscale.com, DNS:shanemdonovan.com, DNS:sisters-movie.link, DNS:starta5k.com, DNS:tmnv.com, DNS:traffic-lawyers.xyz, DNS:twistyband.com, DNS:wantalicious.com

Meta - Revscale.com

Number of occurences: 6
  • Name:
    Content: website
  • Name: viewport
    Content: initial-scale=1
  • Name: description
    Content:
  • Name: keywords
    Content:
  • Name: author
    Content:
  • Name: robots
    Content: noindex, nofollow

Server / Hosting

  • IP: 104.27.163.103
  • Latitude: 37.75
  • Longitude: -97.82
  • Country: United States

Rname

  • nelly.ns.cloudflare.com
  • sam.ns.cloudflare.com
  • alt1.aspmx.l.google.com
  • aspmx.l.google.com
  • alt4.aspmx.l.google.com
  • alt3.aspmx.l.google.com
  • alt2.aspmx.l.google.com

Target

  • dns.cloudflare.com

HTTP Header Response

HTTP/1.1 302 Found Date: Thu, 14 Jul 2016 09:08:47 GMT Content-Type: text/html; charset=utf-8 Set-Cookie: __cfduid=d3cdec06e076954594b31ffbbe4fa0ec71468487326; expires=Fri, 14-Jul-17 09:08:46 GMT; path=/; domain=.revscale.com; HttpOnly X-Frame-Options: ALLOWALL Location: https://revscale.com/under-construction Access-Control-Allow-Origin: * Access-Control-Request-Method: * Cache-Control: no-cache Set-Cookie: _mkra_ctxt=e50c216a0b94ad9f8e32b9d935d2c6f6--302; path=/; max-age=5; HttpOnly X-Request-Id: dd2fc570-9d23-484a-8e23-e8c53906fb69 X-Runtime: 0.009206 X-Rack-Cache: miss Server: cloudflare-nginx CF-RAY: 2c23d50158d12312-LAX X-Cache: MISS from s_fl413 X-Cache-Lookup: MISS from s_fl413:80 Via: 1.1 vegur, 1.1 s_fl413 (squid/3.5.19) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Date: Thu, 14 Jul 2016 09:08:48 GMT Content-Type: text/html; charset=utf-8 Connection: keep-alive Set-Cookie: __cfduid=dbb8badb2753d632dfdea39242235c3ff1468487327; expires=Fri, 14-Jul-17 09:08:47 GMT; path=/; domain=.revscale.com; HttpOnly X-Frame-Options: ALLOWALL Set-Cookie: _mkra_ctxt=003d3494024148190db7c81ce47f5d7f--200; path=/; max-age=5; HttpOnly Cache-Control: max-age=0, private, must-revalidate X-Request-Id: a5a5c573-8592-458a-bcfb-3d93e7e003fd X-Runtime: 0.064291 X-Rack-Cache: miss Via: 1.1 vegur Server: cloudflare-nginx CF-RAY: 2c23d507fb862246-LAX

DNS

host: revscale.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.27.162.103
host: revscale.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.27.163.103
host: revscale.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: nelly.ns.cloudflare.com
host: revscale.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: sam.ns.cloudflare.com
host: revscale.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: nelly.ns.cloudflare.com
  5. rname: dns.cloudflare.com
  6. serial: 2021545062
  7. refresh: 10000
  8. retry: 2400
  9. expire: 604800
  10. minimum-ttl: 3600
host: revscale.com
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 5
  5. target: alt1.aspmx.l.google.com
host: revscale.com
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 1
  5. target: aspmx.l.google.com
host: revscale.com
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 10
  5. target: alt4.aspmx.l.google.com
host: revscale.com
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 10
  5. target: alt3.aspmx.l.google.com
host: revscale.com
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 5
  5. target: alt2.aspmx.l.google.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.evscale.com, www.rievscale.com, www.ievscale.com, www.roevscale.com, www.oevscale.com, www.rlevscale.com, www.levscale.com, www.rlevscale.com, www.levscale.com, www.r.evscale.com, www..evscale.com, www.rvscale.com, www.rexvscale.com, www.rxvscale.com, www.resvscale.com, www.rsvscale.com, www.rewvscale.com, www.rwvscale.com, www.rervscale.com, www.rrvscale.com, www.refvscale.com, www.rfvscale.com, www.revvscale.com, www.rvvscale.com, www.recvscale.com, www.rcvscale.com, www.reqvscale.com, www.rqvscale.com, www.reavscale.com, www.ravscale.com, www.reyvscale.com, www.ryvscale.com, www.rescale.com, www.revyscale.com, www.reyscale.com, www.revzscale.com, www.rezscale.com, www.revhscale.com, www.rehscale.com, www.revnscale.com, www.renscale.com, www.revmscale.com, www.remscale.com, www.revjscale.com, www.rejscale.com, www.revkscale.com, www.rekscale.com, www.reviscale.com, www.reiscale.com, www.revcale.com, www.revsecale.com, www.revecale.com, www.revswcale.com, www.revwcale.com, www.revsdcale.com, www.revdcale.com, www.revsxcale.com, www.revxcale.com, www.revsfcale.com, www.revfcale.com, www.revsgcale.com, www.revgcale.com, www.revstcale.com, www.revtcale.com, www.revsale.com, www.revscdale.com, www.revsdale.com, www.revscrale.com, www.revsrale.com, www.revsctale.com, www.revstale.com, www.revscvale.com, www.revsvale.com, www.revscfale.com, www.revsfale.com, www.revscgale.com, www.revsgale.com, www.revschale.com, www.revshale.com, www.revscnale.com, www.revsnale.com, www.revscmale.com, www.revsmale.com, www.revscjale.com, www.revsjale.com, www.revscle.com, www.revscaole.com, www.revscole.com, www.revscaple.com, www.revscple.com, www.revsca9le.com, www.revsc9le.com, www.revscale.com, www.revscle.com, www.revscaile.com, www.revscile.com, www.revscaule.com, www.revscule.com, www.revscae.com, www.revscalue.com, www.revscaue.com, www.revscal8e.com, www.revsca8e.com, www.revscal9e.com, www.revsca9e.com, www.revscalje.com, www.revscaje.com, www.revscal0e.com, www.revsca0e.com, www.revscalme.com, www.revscame.com, www.revscalpe.com, www.revscape.com, www.revscaloe.com, www.revscaoe.com, www.revscal.com, www.revscalex.com, www.revscalx.com, www.revscales.com, www.revscals.com, www.revscalew.com, www.revscalw.com, www.revscaler.com, www.revscalr.com, www.revscalef.com, www.revscalf.com, www.revscalev.com, www.revscalv.com, www.revscalec.com, www.revscalc.com, www.revscaleq.com, www.revscalq.com, www.revscalea.com, www.revscala.com, www.revscaley.com, www.revscaly.com,

Other websites we recently analyzed

  1. creme anglaise
    Nous Sommes Emilie et Jocelyn, les créateurs des objets de décoration et Mobilier en Bois Crème Anglaise. Nous fabriquons et imaginons avec beaucoup d'amour chaque produits Comme si ils etaient pour nos 3 enfants !!
    France - 195.137.184.101
    Server software: Apache
    Technology: CloudFront, Criteo Publisher Marketplace, CSS, Html, Html5, Iframe, Javascript, Php, eStat, Google Analytics, Google Publisher Tag, Google Tagmanager, Taboola, Facebook Box, Google +1 Button, Linkedin Share button
    Number of Javascript: 5
    Number of meta tags: 4
  2. etffunds.co.uk
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  3. Considines
    Australia - 203.170.86.97
    Server software: nginx
    Technology: CSS, Html, Swf Object
    Number of meta tags: 1
  4. Sie sehen hier eine soeben freigeschaltete Homepage
    Berlin (Germany) - 81.169.145.84
    Server software: Apache/2.2.31 (Unix)
    Technology: Html
    Number of meta tags: 2
  5. FireOver 
    a fast growing company focused on the development of the high quality small fire extinguisher solution FireOver 
    Spain - 217.76.130.138
    Server software: Apache
    Technology: CSS, Flexslider, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, Wordpress
    Number of Javascript: 11
    Number of meta tags: 9
  6. customsignsbyjc.com - Diese Website steht zum Verkauf! - Informationen zum Thema customsignsbyjc.
    Diese Website steht zum Verkauf! customsignsbyjc.com ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf customsignsbyjc.com alles. Wir hoffen, dass Sie hier das Gesuchte finden!
    Cambridge (United States) - 72.52.4.90
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 5
  7. jha.nyc
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  8. Penion Kästner
    Pension Kästner Ihre Pension in Görlitz - Hier übernachten Sie im Herzen der Görlitzer Alststadt.
    Germany - 141.101.32.101
    Server software: Apache/2.2.22 (Debian)
    Technology: CSS, Cufon, Html, Javascript, jQuery, MooTools, Php, SuperFish
    Number of Javascript: 13
    Number of meta tags: 5
  9. camera-peche
    camera peche développe et intègre du matériel vidéo pour des applications extrêmes  dans le domaine terrestre et sous-marin
    France - 62.210.16.61
    Server software: nginx
    Technology: Html
    Number of meta tags: 5
  10. Benjamin Litho
    San Antonio (United States) - 184.106.55.67
    Server software: Sun-ONE-Web-Server/6.1
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Javascript, jQuery, Modernizr.js, Php, Pingback, Wordpress
    Number of Javascript: 27
    Number of meta tags: 4

Check Other Websites